PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676730418
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family MYB
Protein Properties Length: 1659aa    MW: 182426 Da    PI: 6.9967
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676730418genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.35.5e-11867908346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e +++  +++G++ +k+Ia ++   +t  +c+++++k
        676730418 867 PWTSEEKETFLNMLAMHGKD-FKKIATYLT-QKTTADCIDYYYK 908
                      8*****************99.********9.9**********98 PP

2Myb_DNA-binding22.72.3e-0710821123447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT +E   +++++ ++G++ +++I++ +  +R+  qc+ ++ k+
        676730418 1082 WTDDERSAFIQGFSLFGKN-FASISKFVR-TRSQDQCRVFFSKV 1123
                       *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.04E-14850911IPR009057Homeodomain-like
PROSITE profilePS5129315.047863914IPR017884SANT domain
SMARTSM007175.5E-9864912IPR001005SANT/Myb domain
PfamPF002494.4E-9866908IPR001005SANT/Myb domain
CDDcd001671.63E-7867909No hitNo description
Gene3DG3DSA:1.10.10.603.9E-7867915IPR009057Homeodomain-like
PROSITE profilePS5129312.87810771128IPR017884SANT domain
SMARTSM007174.5E-610781126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-410811123IPR009057Homeodomain-like
SuperFamilySSF466895.93E-910811127IPR009057Homeodomain-like
CDDcd001671.71E-510821123No hitNo description
PfamPF002492.7E-610821122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1659 aa     Download sequence    Send to blast
MPQDHASWDR KELLRQRKHD RPEPSFEPAF RWRASPTTPS SHRDFSRYGS GAADFRRPSC  60
HGKQGGRHQF VEDTSHGYTS SRSSTRVFEN DYYRQSGPRG DWRYNRNFRD DRPLSQKDWK  120
CNTWDMSNGS SRAFERPGSL RNGRRSVDER PQHSSDTHTT LVNSWDQANS AHQPDIENST  180
PVRTLKIKNE QKFSDQRLSY PSDPQSECVS LFERPSSENN YGNKSYSPAK QCNDLMVGRR  240
LANDNSLDPP ILNADQEGTW EQLHLKDSQD NTLHGTSDLE GAKICDKESS LGANGKLPVW  300
NRSGSFASQS SGYSHSSSLK SLGAVESSDG KNEVLPKIVA VTRSFSGDAT ACATTTHFTE  360
EMSSRKKQRL GWGEGLAKYE KKKVDVNTNE DGTTLLENST EELHSLNKII ADRSPTTAIP  420
EYGSPTTPSS VGCSSSPGFA DKSSAKAAIA ASDVSNMCRS PSPVSSIPLE QFPINIEEID  480
NNSMERFGCL LNELLATDDS GTGDSISVQL TSMNRLLAWK GDILKAVEMT ESEIDLLENK  540
HRTLMLEGGR HCRVVGSSSH LCEGDLNVAK EQEASCILGP KVAASSVAET LVRDPPVHQA  600
VLAMVPDVFE DSPGQVKSLS QSLVTVENNE DILPIPSMKA SASSKEVNTT AFANQETIEL  660
SSADDSMASN EDLLCAKLLS SNKKYASESS EVFNELLPRD FSSFDGSRFP DICQSQFNSH  720
VNEKIAERVE LLRAREKILL LQFKAFQLAW KKDMHRLASA KYQPKSNRRT ELYPNAKNSG  780
HLKLPQPVRL RFSSSAPRRD SVAYTTELVS YMEKLLHSTR LKPIRDILKM PAMILDEKER  840
LRSRFISSNG LIEDPCDVEK ERTMINPWTS EEKETFLNML AMHGKDFKKI ATYLTQKTTA  900
DCIDYYYKNH KSDCFRKIKK QRAFGKEGKH TYMLAPRKKW KRDMGAASLD ILGAVSIIAA  960
NAGKVASTRQ ISSKRITLRG CSSSNSLQHD GNNSEGCSYS FEIPRKRALG ADVLAVGPLS  1020
SEQINSCVRT SVDSRERCID HLKFDPVVKK PRISHTTHNE KSNEDDDSCS EESCGETVPI  1080
HWTDDERSAF IQGFSLFGKN FASISKFVRT RSQDQCRVFF SKVRKSLGLE CVQSGSGNVS  1140
ASVSVDNAVE GGGSDLEEPC QLESNSAICN DGVSAKMGLS SPTSPFNMNQ EGANHLETAN  1200
VKAGLSRSEQ ENGVTYLRFK DGTNLVKNAY INGGVPGQVS ERCRDLVDNN TVESQCQTTR  1260
KIESQCQAAG KIKSNDLLPM EIDEGNFTSV AVSSDPLYCG SSVLSNMIME SPIESSRKGS  1320
GGQGAALPKQ SLKNQDGVMS AADKTRSSGL ETEAAPSSFR YPECLHHVPI EVSTVDLVGV  1380
SVPQGNPNCL TESESPNSLV GQVVKTNNLG WQFSDVNLDL DGKLGILGLV NPEQNGQLSA  1440
TSTESYQNPW RSVTQDPSRI SRSKSDVIVK TQRTGEGFSL KKCTSSATKP LTIFHKDGRS  1500
GHSRSHSFSL SDTERLDKNG DVKLFGTVLT ADENGSKHKP SPGGSIRSSS TLSRDHDTGH  1560
QYINQQHLQN VPITSYGFWD GNRIQTGLTS LPESAKLLAS CPEAYTAHLK QQAVSTKEIQ  1620
LDVSGILRFG KLIEDRAEVS SGKDEGNIGG VNGVAEAAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-17824916394NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-17824916394NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5469830.0HF546983.1 Arabis alpina myb gene for myb like transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403821.10.0hypothetical protein EUTSA_v10010054mg
TrEMBLV4LND50.0V4LND5_EUTSA; Uncharacterized protein
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein